PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G404400.2.p
Common NameSb01g038250, SORBIDRAFT_01g038250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 329aa    MW: 34462.4 Da    PI: 5.9833
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G404400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd +l+ +   +G+g+W+ ++++ g++R++k+c++r+ +yl
  Sobic.001G404400.2.p 14 KGPWTPEEDAKLLAYTSTHGTGNWTNVPQRAGLKRCGKSCRLRYTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding51.72e-1669110346
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           ++T+eE++l+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  Sobic.001G404400.2.p  69 NFTQEEEDLIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 110
                           89******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-24565IPR009057Homeodomain-like
PROSITE profilePS5129417.415961IPR017930Myb domain
SuperFamilySSF466892.62E-3011108IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
CDDcd001672.62E-111661No hitNo description
PROSITE profilePS5129424.53262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2366116IPR009057Homeodomain-like
SMARTSM007178.5E-1566114IPR001005SANT/Myb domain
CDDcd001674.78E-1269112No hitNo description
PfamPF002497.1E-1569110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGPWTPE EDAKLLAYTS THGTGNWTNV PQRAGLKRCG KSCRLRYTNY  60
LRPNLKHENF TQEEEDLIVT LHAMLGSRWS LIANQLPGRT DNDVKNYWNT KLSKKLRQRG  120
IDPITHRPIA DLMHSIGALA IRPPQPASSS PNGGYLPAPA LPLVHDVAYH AAGMLPPKTE  180
QQQVVIARVD ADAPASPTTT EHGQGQQLKW SDFLADDAAA AAAAAEAQQQ QVVLGQYHHE  240
ASAVGAGSGV AVYGAGSSSS AAAAGGDVGG GGGGDDGAAA FIDAILDCDK ETGVDQLIAE  300
LLADPAYYAG SSSSSSEMGW GMGLLNAD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9670890.0EU967089.1 Zea mays clone 299414 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465411.10.0hypothetical protein SORBIDRAFT_01g038250
TrEMBLC5WNH10.0C5WNH1_SORBI; Putative uncharacterized protein Sb01g038250
STRINGSb01g038250.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.12e-67myb domain protein 103